Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Rabbit Polyclonal Antibody (Biotin)

ITIH5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ITI-HC5, PP14776

UniProt

G5E9D8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITIH5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001851

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pafah1b1 3'UTR Luciferase Stable Cell Line
TU115850 1.0 mL

Pafah1b1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-hHR23A Rabbit Monoclonal Antibody
MA2997-.05 50 µL

Anti-hHR23A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit
MBS9331323-01 48 Well

Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit
MBS9331323-02 96 Well

Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit
MBS9331323-03 5x 96 Well

Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit

Sign In for Pricing
View Details
Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit
MBS9331323-04 10x 96 Well

Rat Tyrosine-protein phosphatase non-receptor type substrate 1, SIRPA ELISA Kit

Sign In for Pricing
View Details