Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT85 Rabbit Polyclonal Antibody (Biotin)

KRT85 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HB5, K85, Hb-5, hHb5, ECTD4, KRTHB5

UniProt

P78386

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT85

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine APOH Protein, Untagged, Native Protein-50ug
QP11053-50ug 50ug

Recombinant Bovine APOH Protein, Untagged, Native Protein-50ug

Sign In for Pricing
View Details
Gcnt2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6589906 1.0 µg DNA

Gcnt2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (FITC) discontinued
031474-FITC 200 µL

ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (FITC) discontinued

Sign In for Pricing
View Details
Anti Multi-Species KLRG-1 Flow Cytometry Monoclonal Clone 2F1 EV450 Ready To Use 100 Tests
IHMSAMLKLRG12F1CEV450100 100 Tests

Anti Multi-Species KLRG-1 Flow Cytometry Monoclonal Clone 2F1 EV450 Ready To Use 100 Tests

Sign In for Pricing
View Details
Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1)
MBS7025216-01 0.02 mg

Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1)

Sign In for Pricing
View Details
Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1)
MBS7025216-02 0.1 mg

Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1)

Sign In for Pricing
View Details