Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A7 Rabbit Polyclonal Antibody (FITC)

MS4A7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CFFM4, MS4A8, 4SPAN2, CD20L4

UniProt

Q9GZW8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MS4A7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_067024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl N-{2-azabicyclo[2.1.1]hexan-4-yl}carbamate
UTD68516-01 50 mg

Tert-Butyl N-{2-azabicyclo[2.1.1]hexan-4-yl}carbamate

Sign In for Pricing
View Details
Tert-Butyl N-{2-azabicyclo[2.1.1]hexan-4-yl}carbamate
UTD68516-02 0.5 g

Tert-Butyl N-{2-azabicyclo[2.1.1]hexan-4-yl}carbamate

Sign In for Pricing
View Details
Glycophorin A (GYPA) (NM_002099) Human Untagged Clone
SC319730 10 µg

Glycophorin A (GYPA) (NM_002099) Human Untagged Clone

Sign In for Pricing
View Details
PPP1R16B, ID (PPP1R16B, ANKRD4, KIAA0823, Protein phosphatase 1 regulatory inhibitor subunit 16B, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, TGF-beta-inhibited membrane-associated protein) (APC)
MBS6336501-01 0.2 mL

PPP1R16B, ID (PPP1R16B, ANKRD4, KIAA0823, Protein phosphatase 1 regulatory inhibitor subunit 16B, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, TGF-beta-inhibited membrane-associated protein) (APC)

Sign In for Pricing
View Details
PPP1R16B, ID (PPP1R16B, ANKRD4, KIAA0823, Protein phosphatase 1 regulatory inhibitor subunit 16B, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, TGF-beta-inhibited membrane-associated protein) (APC)
MBS6336501-02 5x 0.2 mL

PPP1R16B, ID (PPP1R16B, ANKRD4, KIAA0823, Protein phosphatase 1 regulatory inhibitor subunit 16B, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, TGF-beta-inhibited membrane-associated protein) (APC)

Sign In for Pricing
View Details
Bacillus cereus gajB Recombinant Protein (N-His)
JN922022-01 50 µg

Bacillus cereus gajB Recombinant Protein (N-His)

Sign In for Pricing
View Details