Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nefm Rabbit Polyclonal Antibody (Biotin)

Nefm Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nfm, Nef3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nefm

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_058725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nars ORF Vector (Rat) (pORF)
31462016 1.0 µg DNA

Nars ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Galnt18 Mouse shRNA Plasmid (Locus ID 233733)
TR513154 1 Kit

Galnt18 Mouse shRNA Plasmid (Locus ID 233733)

Sign In for Pricing
View Details
Human RBM44 siRNA
abx931076-01 15 nmol

Human RBM44 siRNA

Sign In for Pricing
View Details
Human RBM44 siRNA
abx931076-02 30 nmol

Human RBM44 siRNA

Sign In for Pricing
View Details
VHL Antibody
MBS7120828-01 0.05 mg

VHL Antibody

Sign In for Pricing
View Details
VHL Antibody
MBS7120828-02 0.1 mg

VHL Antibody

Sign In for Pricing
View Details