Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nefm Rabbit Polyclonal Antibody (FITC)

Nefm Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Nfm, Nef3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nefm

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_058725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1307461 (NM_001106854) Rat Untagged Clone
RN210695 10 µg

RGD1307461 (NM_001106854) Rat Untagged Clone

Sign In for Pricing
View Details
GPD1 Polyclonal Antibody, FITC Conjugated
A55996-100 100 µL

GPD1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)
MBS1094970-01 0.02 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)
MBS1094970-02 0.1 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)
MBS1094970-03 0.02 mg (Baculovirus)

Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)
MBS1094970-04 0.02 mg (Mammalian-Cell)

Recombinant Chlorobium phaeobacteroides 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details