Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIA4 Rabbit Polyclonal Antibody (HRP)

PPFIA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O75335

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPFIA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SEC13 shRNA (UAS) - Lentiviral human SEC13 shRNA (UAS, GFP) (25)
GTR15333407 1 Vial

Lentiviral human SEC13 shRNA (UAS) - Lentiviral human SEC13 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit
MBS7228418-01 48 Well

Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit
MBS7228418-02 96 Well

Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit
MBS7228418-03 5x 96 Well

Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit
MBS7228418-04 10x 96 Well

Sheep V-type proton ATPase 116 kDa subunit a isoform 1 (ATP6V0A1) ELISA Kit

Sign In for Pricing
View Details
Dlx-5 (DLX5, Homeobox Protein DLX-5)
313604-01 50 µg

Dlx-5 (DLX5, Homeobox Protein DLX-5)

Sign In for Pricing
View Details