Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB29 Rabbit Polyclonal Antibody (FITC)

RAB29 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAB7L, RAB7L1

UniProt

O14966

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB7L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGA5, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (MaxLight 490)
MBS6311175-01 0.1 mL

ITGA5, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (MaxLight 490)

Sign In for Pricing
View Details
ITGA5, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (MaxLight 490)
MBS6311175-02 5x 0.1 mL

ITGA5, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (MaxLight 490)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)
MBS2150564-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)
MBS2150564-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)
MBS2150564-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)
MBS2150564-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Carbonic Anhydrase IV (CA4)

Sign In for Pricing
View Details