Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB30 Rabbit Polyclonal Antibody (HRP)

RAB30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q15771

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 Folded Slow Qualitative Filter, 110 Mm
QL04P0110C Box of 100

Box of 100 Folded Slow Qualitative Filter, 110 Mm

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
pFlag-CMV4-TCF7L2 Plasmid
PVT19096 2 µg

pFlag-CMV4-TCF7L2 Plasmid

Sign In for Pricing
View Details
CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle
RC226198L4V 200 µL

CDC27 (NM_001114091) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hsa-miR-4257 miRNA Agomir
orb1920518-01 5 nmol

Hsa-miR-4257 miRNA Agomir

Sign In for Pricing
View Details