Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX33 Rabbit Polyclonal Antibody (Biotin)

SNX33 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SNX30, SH3PX3, SH3PXD3C

UniProt

Q8WV41

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX33

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_695003

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ARIH2 Antibody (OTI3F9) [Alexa Fluor 488]
NBP2-71600AF488 0.1 mL

Mouse Monoclonal ARIH2 Antibody (OTI3F9) [Alexa Fluor 488]

Sign In for Pricing
View Details
CD90.2 antibody
MO902A(V100) 100 µg

CD90.2 antibody

Sign In for Pricing
View Details
MDK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1283306 1.0 µg DNA

MDK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra
MBS6000675-01 0.2 mL

AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra

Sign In for Pricing
View Details
AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra
MBS6000675-02 5x 0.2 mL

AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra

Sign In for Pricing
View Details
Rat alpha-1-microglobulin; bikunin precursor, AMBP ELISA KIT
EA0081Ra-01 96 Well

Rat alpha-1-microglobulin; bikunin precursor, AMBP ELISA KIT

Sign In for Pricing
View Details