Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT Rabbit Polyclonal Antibody (HRP)

TIGIT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VSIG9, VSTM3, WUCAM

UniProt

Q495A1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TIGIT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_776160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRFIP1 (Leucine Rich Repeat (in FLII) Interacting Protein 1, FLAP-1, FLIIAP1, GCF-2, GCF2, HUFI-1, MGC10947, MGC119738, MGC119739, TRIP) (Biotin)
MBS6171428-01 0.1 mL

LRRFIP1 (Leucine Rich Repeat (in FLII) Interacting Protein 1, FLAP-1, FLIIAP1, GCF-2, GCF2, HUFI-1, MGC10947, MGC119738, MGC119739, TRIP) (Biotin)

Sign In for Pricing
View Details
LRRFIP1 (Leucine Rich Repeat (in FLII) Interacting Protein 1, FLAP-1, FLIIAP1, GCF-2, GCF2, HUFI-1, MGC10947, MGC119738, MGC119739, TRIP) (Biotin)
MBS6171428-02 5x 0.1 mL

LRRFIP1 (Leucine Rich Repeat (in FLII) Interacting Protein 1, FLAP-1, FLIIAP1, GCF-2, GCF2, HUFI-1, MGC10947, MGC119738, MGC119739, TRIP) (Biotin)

Sign In for Pricing
View Details
Protein Synthesis Initiation Factor 2 alpha (Eukaryotic Translation Initiation Factor 2 alpha, Eukaryotic Translation Initiation Factor 2 Subunit 1 alpha 35kDa, eIF2 alpha, eIF2alpha, eIF-2-alpha, eIF-2alpha, eIF 2a, eIF2a, eIF-2a, CDA02, eIF2S1) (MaxLigh
MBS6259287-01 0.1 mL

Protein Synthesis Initiation Factor 2 alpha (Eukaryotic Translation Initiation Factor 2 alpha, Eukaryotic Translation Initiation Factor 2 Subunit 1 alpha 35kDa, eIF2 alpha, eIF2alpha, eIF-2-alpha, eIF-2alpha, eIF 2a, eIF2a, eIF-2a, CDA02, eIF2S1) (MaxLigh

Sign In for Pricing
View Details
Protein Synthesis Initiation Factor 2 alpha (Eukaryotic Translation Initiation Factor 2 alpha, Eukaryotic Translation Initiation Factor 2 Subunit 1 alpha 35kDa, eIF2 alpha, eIF2alpha, eIF-2-alpha, eIF-2alpha, eIF 2a, eIF2a, eIF-2a, CDA02, eIF2S1) (MaxLigh
MBS6259287-02 5x 0.1 mL

Protein Synthesis Initiation Factor 2 alpha (Eukaryotic Translation Initiation Factor 2 alpha, Eukaryotic Translation Initiation Factor 2 Subunit 1 alpha 35kDa, eIF2 alpha, eIF2alpha, eIF-2-alpha, eIF-2alpha, eIF 2a, eIF2a, eIF-2a, CDA02, eIF2S1) (MaxLigh

Sign In for Pricing
View Details
GLTP siRNA (Human)
MBS8229481-01 15 nmol

GLTP siRNA (Human)

Sign In for Pricing
View Details
GLTP siRNA (Human)
MBS8229481-02 30 nmol

GLTP siRNA (Human)

Sign In for Pricing
View Details