Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Akirin2 Rabbit Polyclonal Antibody (HRP)

Akirin2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA114675, AA522011, AU019887, Akirin-2, 2700059D21Rik

UniProt

B1AXD8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Akirin2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHSL1 shRNA (m) Lentiviral Particles
sc-149966-V 200 µL

NHSL1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Human KLHL32 siRNA
abx921786-01 15 nmol

Human KLHL32 siRNA

Sign In for Pricing
View Details
Human KLHL32 siRNA
abx921786-02 30 nmol

Human KLHL32 siRNA

Sign In for Pricing
View Details
SDHAF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2109006 1.0 µg DNA

SDHAF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fish Peptide Y ELISA Kit
MBS014686 Inquire

Fish Peptide Y ELISA Kit

Sign In for Pricing
View Details
Spermidine Synthase (SRM) Antibody
abx110224-01 20 µg

Spermidine Synthase (SRM) Antibody

Sign In for Pricing
View Details