Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARRDC4 Rabbit Polyclonal Antibody (FITC)

ARRDC4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ36045

UniProt

Q8NCT1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARRDC4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGAEGRVKSLGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_899232

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Transmembrane Protease, Serine 6 (TMPRSS6), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030786 96 Tests

Multiplex Assay Kit for Transmembrane Protease, Serine 6 (TMPRSS6), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Human sphingosine 1-phosphate ELISA kit
GTR10391868 96 Well

Human sphingosine 1-phosphate ELISA kit

Sign In for Pricing
View Details
Lentiviral human RAB7B shRNA (UAS) - Lentiviral human RAB7B shRNA (UAS, iRFP) plasmid
GTR15316891 1 Vial

Lentiviral human RAB7B shRNA (UAS) - Lentiviral human RAB7B shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein (HSP70) Antibody (ATTO488)
abx440282 200 µg

Heat Shock 70 kDa Protein (HSP70) Antibody (ATTO488)

Sign In for Pricing
View Details
ADAM 17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942) (MaxLight 750) discontinued
122966-ML750 100 µL

ADAM 17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942) (MaxLight 750) discontinued

Sign In for Pricing
View Details
C1GALT1C1L (NM_001101330) Human Tagged Lenti ORF Clone
RC225449L4 10 µg

C1GALT1C1L (NM_001101330) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details