Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chmp4c Rabbit Polyclonal Antibody (Biotin)

Chmp4c Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Snf7, Shax3, Snf7-3, 2010012P02Rik, 2210015K02Rik, 2310010I16Rik

UniProt

Q9D7F7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079795

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kindlin 2 Antibody / KIND2
orb1151802-01 20 µg

Kindlin 2 Antibody / KIND2

Sign In for Pricing
View Details
Kindlin 2 Antibody / KIND2
orb1151802-02 100 µg

Kindlin 2 Antibody / KIND2

Sign In for Pricing
View Details
Rotary Mixer Adapters
SMV-R-C 30x 1.5 (2.0) mL

Rotary Mixer Adapters

Sign In for Pricing
View Details
Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) BioAssayTM ELISA Kit (Rat)
026459 96 Tests

Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Rabbit Anti-LOC4343719 Antibody (MOFAB-200W)
MOFAB-200W Each

Rabbit Anti-LOC4343719 Antibody (MOFAB-200W)

Sign In for Pricing
View Details
Lentiviral human ASXL3 shRNA (UAS) - Lentiviral human ASXL3 shRNA (UAS, GFP) (25)
GTR15090308 1 Vial

Lentiviral human ASXL3 shRNA (UAS) - Lentiviral human ASXL3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details