Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chmp4c Rabbit Polyclonal Antibody (Biotin)

Chmp4c Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Snf7, Shax3, Snf7-3, 2010012P02Rik, 2210015K02Rik, 2310010I16Rik

UniProt

Q9D7F7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079795

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat alpha-L-fucosidase, AFU ELISA Kit
MBS165107-01 48 Well

Rat alpha-L-fucosidase, AFU ELISA Kit

Sign In for Pricing
View Details
Rat alpha-L-fucosidase, AFU ELISA Kit
MBS165107-02 96 Well

Rat alpha-L-fucosidase, AFU ELISA Kit

Sign In for Pricing
View Details
Rat alpha-L-fucosidase, AFU ELISA Kit
MBS165107-03 5x 96 Well

Rat alpha-L-fucosidase, AFU ELISA Kit

Sign In for Pricing
View Details
Rat alpha-L-fucosidase, AFU ELISA Kit
MBS165107-04 10x 96 Well

Rat alpha-L-fucosidase, AFU ELISA Kit

Sign In for Pricing
View Details
AAAS Protein Vector (Human) (pPB-C-His)
PV000017 500 ng

AAAS Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PIP5K1C (Phosphatidylinositol-4-Phosphate 5-Kinase, Type I, gamma, KIAA0589, LCCS3, PIP5K-GAMMA, PIP5Kgamma) (HRP)
MBS6182654-01 0.1 mL

PIP5K1C (Phosphatidylinositol-4-Phosphate 5-Kinase, Type I, gamma, KIAA0589, LCCS3, PIP5K-GAMMA, PIP5Kgamma) (HRP)

Sign In for Pricing
View Details