Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT6L Rabbit Polyclonal Antibody (HRP)

CNOT6L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCR4b

UniProt

Q96LI5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CNOT6L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neomycin solution
sc-255391 20 mL

Neomycin solution

Sign In for Pricing
View Details
Lentiviral human ATAD1 shRNA (UAS) - Lentiviral human ATAD1 shRNA (UAS, GFP) (100)
GTR15135225 1 Vial

Lentiviral human ATAD1 shRNA (UAS) - Lentiviral human ATAD1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Musclin (D-7) : m-IgG1 BP-HRP Bundle
sc-543503 1 Kit

Musclin (D-7) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral mouse Slc5a12 shRNA (UAS) - Lentiviral mouseSlc5a12 shRNA (UAS, GFP) (25)
GTR15119336 1 Vial

Lentiviral mouse Slc5a12 shRNA (UAS) - Lentiviral mouseSlc5a12 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-OLIG2 Antibody Picoband® (Biotine Conjugate)
A02247-2-Biotin 100 µg/Vial

Anti-OLIG2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
hsa-miR-4726-5p miRNA Antagomir
MBS8317520-01 10 nmol

hsa-miR-4726-5p miRNA Antagomir

Sign In for Pricing
View Details