Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf40A Rabbit Polyclonal Antibody (FITC)

CXorf40A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CXorf40, CXorf40A

UniProt

Q8TE69

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXorf40A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lamp1 shRNA (UAS) - Lentiviral mouse Lamp1 shRNA (UAS, RFP) (100)
GTR15161592 1 Vial

Lentiviral mouse Lamp1 shRNA (UAS) - Lentiviral mouse Lamp1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rat Caspase 7 (CASP7) CLIA Kit
abx196791-01 96 Tests

Rat Caspase 7 (CASP7) CLIA Kit

Sign In for Pricing
View Details
Rat Caspase 7 (CASP7) CLIA Kit
abx196791-02 5x 96 Tests

Rat Caspase 7 (CASP7) CLIA Kit

Sign In for Pricing
View Details
Rat Caspase 7 (CASP7) CLIA Kit
abx196791-03 10x 96 Tests

Rat Caspase 7 (CASP7) CLIA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal FAM136A Antibody [DyLight 350]
NBP2-97426UV 0.1 mL

Rabbit Polyclonal FAM136A Antibody [DyLight 350]

Sign In for Pricing
View Details
Hamster Translocon-Associated Protein Subunit Delta (SSR4) ELISA Kit
MBS9943371-01 48 Well

Hamster Translocon-Associated Protein Subunit Delta (SSR4) ELISA Kit

Sign In for Pricing
View Details