Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1LI2 Rabbit Polyclonal Antibody (Biotin)

DYNC1LI2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LIC2, DNCLI2

UniProt

B4DZP4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DYNC1LI2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNK Protein Vector (Mouse) (pPM-C-His)
PV244233 500 ng

UNK Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)
MBS1499849-01 0.05 mg

Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)
MBS1499849-02 0.1 mg

Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)
MBS1499849-03 5x 0.1 mg

Rabbit anti-Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit alpha polyclonal Antibody(nrdA)

Sign In for Pricing
View Details
Swine Heat Shock Protein 70 (HSP70) ELISA Kit-Sandwich
EK1F213-01 48 Test

Swine Heat Shock Protein 70 (HSP70) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Swine Heat Shock Protein 70 (HSP70) ELISA Kit-Sandwich
EK1F213-02 96 Tests

Swine Heat Shock Protein 70 (HSP70) ELISA Kit-Sandwich

Sign In for Pricing
View Details