Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCHO2 Rabbit Polyclonal Antibody (HRP)

FCHO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q0JRZ9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCHO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  40nm
GP-6401-40 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 40nm

Sign In for Pricing
View Details
Human COL6A5 activation kit by CRISPRa
GA116845 1 Kit

Human COL6A5 activation kit by CRISPRa

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), 0.2mg/mL
BNUB1964-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), 0.2mg/mL

Sign In for Pricing
View Details
Vmn1r34 Mouse Gene Knockout Kit (CRISPR)
KN519046 1 Kit

Vmn1r34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®680R-Dextran 10,000 MW, Anionic and Fixable
#80116 1x 1 mg

CF®680R-Dextran 10,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001114136) Human Over-expression Lysate
LC426464 20 µg

Dematin (DMTN) (NM_001114136) Human Over-expression Lysate

Sign In for Pricing
View Details