Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD2 Rabbit Polyclonal Antibody (Biotin)

FSD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPRYD1

UniProt

A1L4K1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FSD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDI1 (Guanosine Diphosphate Dissociation Inhibitor 1, GDP Dissociation Inhibitor 1, GDI-1, FLJ41411, GDIL, MRX41, MRX48, Oligophrenin-2, OPHN2, Protein XAP-4, Rab GDP Dissociation Inhibitor alpha, Rab GDI alpha, RABGDIA, XAP4) (MaxLight 650)
127258-ML650 100 µL

GDI1 (Guanosine Diphosphate Dissociation Inhibitor 1, GDP Dissociation Inhibitor 1, GDI-1, FLJ41411, GDIL, MRX41, MRX48, Oligophrenin-2, OPHN2, Protein XAP-4, Rab GDP Dissociation Inhibitor alpha, Rab GDI alpha, RABGDIA, XAP4) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal Hsp40/YDJ1 Antibody (1G10.H8) [FITC]
NBP2-12879F 100 µL

Mouse Monoclonal Hsp40/YDJ1 Antibody (1G10.H8) [FITC]

Sign In for Pricing
View Details
Human Varicella zoster virus IgG, VZV-IgG ELISA KIT
CK-bio-13929-01 48 Tests

Human Varicella zoster virus IgG, VZV-IgG ELISA KIT

Sign In for Pricing
View Details
Human Varicella zoster virus IgG, VZV-IgG ELISA KIT
CK-bio-13929-02 96 Tests

Human Varicella zoster virus IgG, VZV-IgG ELISA KIT

Sign In for Pricing
View Details
Human Varicella zoster virus IgG, VZV-IgG ELISA KIT
CK-bio-13929-03 5x 96 Tests

Human Varicella zoster virus IgG, VZV-IgG ELISA KIT

Sign In for Pricing
View Details
Human Varicella zoster virus IgG, VZV-IgG ELISA KIT
CK-bio-13929-04 10x 96 Tests

Human Varicella zoster virus IgG, VZV-IgG ELISA KIT

Sign In for Pricing
View Details