Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD2 Rabbit Polyclonal Antibody (FITC)

FSD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPRYD1

UniProt

A1L4K1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FSD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A, CT (CD8A, MAL, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, CD8a) (MaxLight 550)
MBS6283551-01 0.1 mL

CD8A, CT (CD8A, MAL, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, CD8a) (MaxLight 550)

Sign In for Pricing
View Details
CD8A, CT (CD8A, MAL, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, CD8a) (MaxLight 550)
MBS6283551-02 5x 0.1 mL

CD8A, CT (CD8A, MAL, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, CD8a) (MaxLight 550)

Sign In for Pricing
View Details
Rat Cltc Pre-designed siRNA Set A
SI202926A 1 Each

Rat Cltc Pre-designed siRNA Set A

Sign In for Pricing
View Details
HHLA2, NT (HHLA2, HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2) (FITC) discontinued
036539-FITC 200 µL

HHLA2, NT (HHLA2, HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral human PFKFB2 shRNA (UAS) - Lentiviral human PFKFB2 shRNA (UAS, iRFP) plasmid
GTR15105448 1 Vial

Lentiviral human PFKFB2 shRNA (UAS) - Lentiviral human PFKFB2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ARHGAP27 Antibody
CSB-PA741070LA01HU-01 50 µg

ARHGAP27 Antibody

Sign In for Pricing
View Details