Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG3 Rabbit Polyclonal Antibody (FITC)

GNG3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P63215

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GNG3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036334

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Petrii rpsU Protein (aa 1-70)
VAng-Lsx4773-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Petrii rpsU Protein (aa 1-70)

Sign In for Pricing
View Details
C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2) (MaxLight 550)
124120-ML550 100 µL

C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2) (MaxLight 550)

Sign In for Pricing
View Details
Pgr15l Mouse siRNA Oligo Duplex (Locus ID 245526)
SR414858 1 Kit

Pgr15l Mouse siRNA Oligo Duplex (Locus ID 245526)

Sign In for Pricing
View Details
Recombinant Human TNS3 Protein, N-His
bs-107102P-01 20 µg

Recombinant Human TNS3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TNS3 Protein, N-His
bs-107102P-02 50 µg

Recombinant Human TNS3 Protein, N-His

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Tagged ORF Clone Lentiviral Particle
RC210245L2V 200 µL

Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details