Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2BP2 Rabbit Polyclonal Antibody (HRP)

IRF2BP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CVID14

UniProt

Q7Z5L9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IRF2BP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001070865

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (FITC)
125838-FITC 100 µL

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (FITC)

Sign In for Pricing
View Details
Mouse Epidermal Basement Membrane Zone ELISA Kit
MBS016660-01 48 Strip Well

Mouse Epidermal Basement Membrane Zone ELISA Kit

Sign In for Pricing
View Details
Mouse Epidermal Basement Membrane Zone ELISA Kit
MBS016660-02 96 Strip Well

Mouse Epidermal Basement Membrane Zone ELISA Kit

Sign In for Pricing
View Details
Mouse Epidermal Basement Membrane Zone ELISA Kit
MBS016660-03 5x 96 Strip Well

Mouse Epidermal Basement Membrane Zone ELISA Kit

Sign In for Pricing
View Details
Mouse Epidermal Basement Membrane Zone ELISA Kit
MBS016660-04 10x 96 Strip Well

Mouse Epidermal Basement Membrane Zone ELISA Kit

Sign In for Pricing
View Details
Mouse Pdia6 qPCR Primer Pair
QM40290S 200 Tests

Mouse Pdia6 qPCR Primer Pair

Sign In for Pricing
View Details