Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC1 Rabbit Polyclonal Antibody (HRP)

LRRC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LANO, dJ523E19.1

UniProt

Q9BTT6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRND

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005249264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cast activation kit by CRISPRa
GA200546 1 Kit

Mouse Cast activation kit by CRISPRa

Sign In for Pricing
View Details
EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, EXOC3, SEC6, SEC6L1) (MaxLight 650)
MBS6455928-01 0.1 mL

EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, EXOC3, SEC6, SEC6L1) (MaxLight 650)

Sign In for Pricing
View Details
EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, EXOC3, SEC6, SEC6L1) (MaxLight 650)
MBS6455928-02 5x 0.1 mL

EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, EXOC3, SEC6, SEC6L1) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain
MBS9421061-01 0.02 mg

Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain

Sign In for Pricing
View Details
Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain
MBS9421061-02 0.1 mg

Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain

Sign In for Pricing
View Details
Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain
MBS9421061-03 1 mg

Recombinant mouse H-2 class I histocompatibility antigen, D-D alpha chain

Sign In for Pricing
View Details