Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKAP Rabbit Polyclonal Antibody (HRP)

NKAP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRXSHD

UniProt

Q8N5F7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKAP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK16 (NM_001008910) Human Over-expression Lysate
E45H03972-2 20 µg

STK16 (NM_001008910) Human Over-expression Lysate

Sign In for Pricing
View Details
Rad54 (F-11) Alexa Fluor® 594
sc-374598 AF594 200 µg/mL

Rad54 (F-11) Alexa Fluor® 594

Sign In for Pricing
View Details
SORBS1, ID (SORBS1, KIAA0894, KIAA1296, SH3D5, Sorbin and SH3 domain-containing protein 1, Ponsin, SH3 domain protein 5, SH3P12, c-Cbl-associated protein) (MaxLight 650)
MBS6349812-01 0.1 mL

SORBS1, ID (SORBS1, KIAA0894, KIAA1296, SH3D5, Sorbin and SH3 domain-containing protein 1, Ponsin, SH3 domain protein 5, SH3P12, c-Cbl-associated protein) (MaxLight 650)

Sign In for Pricing
View Details
SORBS1, ID (SORBS1, KIAA0894, KIAA1296, SH3D5, Sorbin and SH3 domain-containing protein 1, Ponsin, SH3 domain protein 5, SH3P12, c-Cbl-associated protein) (MaxLight 650)
MBS6349812-02 5x 0.1 mL

SORBS1, ID (SORBS1, KIAA0894, KIAA1296, SH3D5, Sorbin and SH3 domain-containing protein 1, Ponsin, SH3 domain protein 5, SH3P12, c-Cbl-associated protein) (MaxLight 650)

Sign In for Pricing
View Details
RPL7AP45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV775381 1.0 µg DNA

RPL7AP45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
YAF2 CRISPR/Cas9 KO Plasmid (h)
sc-417274 20 µg

YAF2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details