Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP54 Rabbit Polyclonal Antibody (HRP)

NUP54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC13407

UniProt

Q7Z3B4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUP54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059122

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42EP2, CT (CDC42EP2, BORG1, CEP2, Cdc42 effector protein 2, Binder of Rho GTPases 1) (Azide free) (HRP)
MBS6283933-01 0.2 mL

CDC42EP2, CT (CDC42EP2, BORG1, CEP2, Cdc42 effector protein 2, Binder of Rho GTPases 1) (Azide free) (HRP)

Sign In for Pricing
View Details
CDC42EP2, CT (CDC42EP2, BORG1, CEP2, Cdc42 effector protein 2, Binder of Rho GTPases 1) (Azide free) (HRP)
MBS6283933-02 5x 0.2 mL

CDC42EP2, CT (CDC42EP2, BORG1, CEP2, Cdc42 effector protein 2, Binder of Rho GTPases 1) (Azide free) (HRP)

Sign In for Pricing
View Details
K0415, ID (AP5Z1, KIAA0415, SPG48, AP-5 complex subunit zeta-1, Adapter-related protein complex 5 zeta subunit) (MaxLight 490)
MBS6311890-01 0.1 mL

K0415, ID (AP5Z1, KIAA0415, SPG48, AP-5 complex subunit zeta-1, Adapter-related protein complex 5 zeta subunit) (MaxLight 490)

Sign In for Pricing
View Details
K0415, ID (AP5Z1, KIAA0415, SPG48, AP-5 complex subunit zeta-1, Adapter-related protein complex 5 zeta subunit) (MaxLight 490)
MBS6311890-02 5x 0.1 mL

K0415, ID (AP5Z1, KIAA0415, SPG48, AP-5 complex subunit zeta-1, Adapter-related protein complex 5 zeta subunit) (MaxLight 490)

Sign In for Pricing
View Details
Zbtb7b 3'UTR Luciferase Stable Cell Line
TU223573 1.0 mL

Zbtb7b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF
PROTP51642-2-5ug 5 µg

Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF

Sign In for Pricing
View Details