Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POF1B Rabbit Polyclonal Antibody (HRP)

POF1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POF, POF2B

UniProt

Q8WVV4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POF1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEKDREICRLRSQLNQYHKDVSKREGSCSDFQFKLHELTSLLEEKDSLIK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079197

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Epididymal protein 4, HE4 ELISA Kit
MBS166658-01 48 Well

Human Epididymal protein 4, HE4 ELISA Kit

Sign In for Pricing
View Details
Human Epididymal protein 4, HE4 ELISA Kit
MBS166658-02 96 Well

Human Epididymal protein 4, HE4 ELISA Kit

Sign In for Pricing
View Details
Human Epididymal protein 4, HE4 ELISA Kit
MBS166658-03 5x 96 Well

Human Epididymal protein 4, HE4 ELISA Kit

Sign In for Pricing
View Details
Human Epididymal protein 4, HE4 ELISA Kit
MBS166658-04 10x 96 Well

Human Epididymal protein 4, HE4 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial
orb2666511-01 20 µg

Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial

Sign In for Pricing
View Details
Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial
orb2666511-02 100 µg

Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial

Sign In for Pricing
View Details