Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPYR1 Rabbit Polyclonal Antibody (FITC)

PPYR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Y4, PP1, PPYR1, NPY4-R

UniProt

P50391

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPYR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_005963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niemann Pick C2/NPC2 Rabbit Polyclonal Antibody (HRP)
orb2607138 100 µg

Niemann Pick C2/NPC2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit
MBS109284-01 48 Well

Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit

Sign In for Pricing
View Details
Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit
MBS109284-02 96 Well

Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit

Sign In for Pricing
View Details
Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit
MBS109284-03 5x 96 Well

Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit

Sign In for Pricing
View Details
Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit
MBS109284-04 10x 96 Well

Mouse WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit

Sign In for Pricing
View Details
Alpha-tubulin Antibody
orb620993-01 50 μL

Alpha-tubulin Antibody

Sign In for Pricing
View Details