Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY4R Rabbit Polyclonal Antibody (HRP)

NPY4R Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Y4, PP1, PPYR1, NPY4-R

UniProt

P50391

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPY4R

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005277701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF15, ID (TNFSF15, TL1, VEGI, Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand
MBS6357045-01 0.2 mL

TNFSF15, ID (TNFSF15, TL1, VEGI, Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand

Sign In for Pricing
View Details
TNFSF15, ID (TNFSF15, TL1, VEGI, Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand
MBS6357045-02 5x 0.2 mL

TNFSF15, ID (TNFSF15, TL1, VEGI, Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand

Sign In for Pricing
View Details
A4GNT CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10947154 3x 1.0 µg DNA

A4GNT CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
SerpinB8 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-19660R-APC-Cy5.5 100 µL

SerpinB8 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
PHF13 Antibody
MBS9400559-01 0.1 mL

PHF13 Antibody

Sign In for Pricing
View Details
PHF13 Antibody
MBS9400559-02 5x 0.1 mL

PHF13 Antibody

Sign In for Pricing
View Details