Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB41 Rabbit Polyclonal Antibody (HRP)

RAB41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5JT25

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSGKTSIISRFMYNSFGCAC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001027898

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-zebrafish Grik1b Antibody, APC Conjugate
DZ33993-APC 200 µL/Vial

Anti-zebrafish Grik1b Antibody, APC Conjugate

Sign In for Pricing
View Details
Ccr9 AAV siRNA Pooled Vector
15433164 1.0 µg

Ccr9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Gbp7 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3643604 1.0 µg DNA

Gbp7 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TNNI1 (Troponin I, Slow Skeletal Muscle, Troponin I, Slow-twitch isoform, TNN1, SSTNI) (MaxLight 650)
MBS6225141-01 0.1 mL

TNNI1 (Troponin I, Slow Skeletal Muscle, Troponin I, Slow-twitch isoform, TNN1, SSTNI) (MaxLight 650)

Sign In for Pricing
View Details
TNNI1 (Troponin I, Slow Skeletal Muscle, Troponin I, Slow-twitch isoform, TNN1, SSTNI) (MaxLight 650)
MBS6225141-02 5x 0.1 mL

TNNI1 (Troponin I, Slow Skeletal Muscle, Troponin I, Slow-twitch isoform, TNN1, SSTNI) (MaxLight 650)

Sign In for Pricing
View Details
Human CellExp™ HGF, Human Recombinant
6456-10 10 µg

Human CellExp™ HGF, Human Recombinant

Sign In for Pricing
View Details