Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC31B Rabbit Polyclonal Antibody (FITC)

SEC31B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SEC31L2, SEC31B-1

UniProt

Q9NQW1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SEC31B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_056305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTUS1 (Microtubule-associated Tumor Suppressor 1, AT2 Receptor-binding Protein, Angiotensin-II Type 2 Receptor-interacting Protein, Mitochondrial Tumor Suppressor 1, ATBP, ATIP, GK1, KIAA1288, MTSG1, DKFZp586D1519, DKFZp686F20243, FLJ14295, KIAA1288) (FITC)
129996-FITC 100 µL

MTUS1 (Microtubule-associated Tumor Suppressor 1, AT2 Receptor-binding Protein, Angiotensin-II Type 2 Receptor-interacting Protein, Mitochondrial Tumor Suppressor 1, ATBP, ATIP, GK1, KIAA1288, MTSG1, DKFZp586D1519, DKFZp686F20243, FLJ14295, KIAA1288) (FITC)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)
MBS1218755-01 0.02 mg (E-Coli)

Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)
MBS1218755-02 0.02 mg (Yeast)

Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)
MBS1218755-03 0.1 mg (E-Coli)

Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)
MBS1218755-04 0.1 mg (Yeast)

Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)
MBS1218755-05 0.02 mg (Baculovirus)

Recombinant Petrotoga mobilis Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details