Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN2A Rabbit Polyclonal Antibody (HRP)

SPIN2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DXF34, SPIN2, TDRD25, dJ323P24.1

UniProt

Q99865

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPIN2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTKKKVSQKKQRGRPSSQPCRNIVGCRISHGWKEGDEPITQWKGTVLDQV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAA70988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP2, Recombinant, Human, aa1186-1389, His-Tag (Low-density Lipoprotein Receptor-related Protein 2)
374081-01 20 µg

LRP2, Recombinant, Human, aa1186-1389, His-Tag (Low-density Lipoprotein Receptor-related Protein 2)

Sign In for Pricing
View Details
LRP2, Recombinant, Human, aa1186-1389, His-Tag (Low-density Lipoprotein Receptor-related Protein 2)
374081-02 100 µg

LRP2, Recombinant, Human, aa1186-1389, His-Tag (Low-density Lipoprotein Receptor-related Protein 2)

Sign In for Pricing
View Details
LEG7 antibody
70R-33826 0.1 mg

LEG7 antibody

Sign In for Pricing
View Details
PE-Cyanine7 Anti-Mouse CD3e (145-2C11)
orb1215210-01 25 µg

PE-Cyanine7 Anti-Mouse CD3e (145-2C11)

Sign In for Pricing
View Details
PE-Cyanine7 Anti-Mouse CD3e (145-2C11)
orb1215210-02 100 µg

PE-Cyanine7 Anti-Mouse CD3e (145-2C11)

Sign In for Pricing
View Details
PAPOLB Protein Vector (Mouse) (pPM-C-His)
PV213445 500 ng

PAPOLB Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details