Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYTL5 Rabbit Polyclonal Antibody (FITC)

SYTL5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Slp5

UniProt

Q8TDW5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SYTL5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW59450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rbm24 Antibody
A58359-50UG 50 µg

rbm24 Antibody

Sign In for Pricing
View Details
CAMK2G (NM_172171) Human Tagged Lenti ORF Clone
RC221653L3 10 µg

CAMK2G (NM_172171) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)
MBS1384633-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)
MBS1384633-02 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)
MBS1384633-03 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)
MBS1384633-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Mitochondrial translocator assembly and maintenance protein 41 homolog (DDB_G0277049)

Sign In for Pricing
View Details