Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYTL5 Rabbit Polyclonal Antibody (HRP)

SYTL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Slp5

UniProt

Q8TDW5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SYTL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW59450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA2 (Golgin Subfamily A Member 2, 130 kDa cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672)
MBS642641-01 0.1 mg

GOLGA2 (Golgin Subfamily A Member 2, 130 kDa cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672)

Sign In for Pricing
View Details
GOLGA2 (Golgin Subfamily A Member 2, 130 kDa cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672)
MBS642641-02 5x 0.1 mg

GOLGA2 (Golgin Subfamily A Member 2, 130 kDa cis-Golgi Matrix Protein, GM130 Autoantigen, Golgin-95, GM130, MGC20672)

Sign In for Pricing
View Details
Rabbit Polyclonal TCF-12/HTF4 Antibody [PerCP]
NB100-2337PCP 0.1 mL

Rabbit Polyclonal TCF-12/HTF4 Antibody [PerCP]

Sign In for Pricing
View Details
LY 227942
T32995 25 mg

LY 227942

Sign In for Pricing
View Details
Triiodothyronine (T3) (MaxLight 650) discontinued
T8425-07E-ML650 100 µL

Triiodothyronine (T3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RNU4-9P Protein Vector (Human) (pPB-C-His)
PV118534 500 ng

RNU4-9P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details