Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCEL Rabbit Polyclonal Antibody (HRP)

TBCEL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

El, LRRC35

UniProt

Q5QJ74

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBCEL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689928

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ITIH4 Protein Lysate
MBS8413763-01 0.02 mg

Human ITIH4 Protein Lysate

Sign In for Pricing
View Details
Human ITIH4 Protein Lysate
MBS8413763-02 5x 0.02 mg

Human ITIH4 Protein Lysate

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1349342 Inquire

Recombinant Yersinia pestis bv. Antiqua Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Lentiviral human LIAS shRNA (UAS) - Lentiviral human LIAS shRNA (UAS, GFP) (100)
GTR15148017 1 Vial

Lentiviral human LIAS shRNA (UAS) - Lentiviral human LIAS shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MN1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1313703 1.0 µg DNA

MN1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal LEKR1 Antibody [DyLight 488]
NBP3-06248G 0.1 mL

Rabbit Polyclonal LEKR1 Antibody [DyLight 488]

Sign In for Pricing
View Details