Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED2 Rabbit Polyclonal Antibody (Biotin)

TMED2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P24, P24A, RNP24, p24b1, p24beta1

UniProt

Q15363

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TMED2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006806

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Stenomitos rutilans Proteinase Inhibitor Pab
272290 100 µg

Anti Stenomitos rutilans Proteinase Inhibitor Pab

Sign In for Pricing
View Details
CDK1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1810032 100 µL

CDK1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit
MBS046307-01 48 Well

Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit

Sign In for Pricing
View Details
Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit
MBS046307-02 96 Well

Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit

Sign In for Pricing
View Details
Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit
MBS046307-03 5x 96 Well

Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit

Sign In for Pricing
View Details
Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit
MBS046307-04 10x 96 Well

Porcine Fatty Acid Binding Protein 7, Brain ELISA Kit

Sign In for Pricing
View Details