Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT2 Rabbit Polyclonal Antibody (HRP)

ADAT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAD2, DEADC1, dJ20N2, dJ20N2.1

UniProt

Q7Z6V5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKEC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_872309

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF607 cDNA Clone
MBS1278293-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZNF607 cDNA Clone

Sign In for Pricing
View Details
ZNF607 cDNA Clone
MBS1278293-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZNF607 cDNA Clone

Sign In for Pricing
View Details
Cytokeratin HMW Overexpression Lysate (Native) - (Dry Ice)
NBP2-07126 0.1 mg

Cytokeratin HMW Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Phospho-CD40 (Thr254) BioAssayTM ELISA Kit
472920 2x 96 Tests

Phospho-CD40 (Thr254) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Ultrasonic Cell Crusher; Ultrasonic Homogenizer; Ultrasonic Cell Disruptor
E0384 1 Unit

Ultrasonic Cell Crusher; Ultrasonic Homogenizer; Ultrasonic Cell Disruptor

Sign In for Pricing
View Details
Recombinant Salmonella arizonae 6-phosphogluconolactonase (pgl)
MBS1096755-01 0.02 mg (E-Coli)

Recombinant Salmonella arizonae 6-phosphogluconolactonase (pgl)

Sign In for Pricing
View Details