Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT2 Rabbit Polyclonal Antibody (Biotin)

ADAT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TAD2, DEADC1, dJ20N2, dJ20N2.1

UniProt

Q7Z6V5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAT2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_872309

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD159a (NK cell receptor A) ELISA Kit
MBS7615496-01 48 Well

Human CD159a (NK cell receptor A) ELISA Kit

Sign In for Pricing
View Details
Human CD159a (NK cell receptor A) ELISA Kit
MBS7615496-02 96 Well

Human CD159a (NK cell receptor A) ELISA Kit

Sign In for Pricing
View Details
Human CD159a (NK cell receptor A) ELISA Kit
MBS7615496-03 5x 96 Well

Human CD159a (NK cell receptor A) ELISA Kit

Sign In for Pricing
View Details
Human CD159a (NK cell receptor A) ELISA Kit
MBS7615496-04 10x 96 Well

Human CD159a (NK cell receptor A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CD66b/CEACAM8 Protein, N-His
orb2968707-01 50 µg

Recombinant Human CD66b/CEACAM8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD66b/CEACAM8 Protein, N-His
orb2968707-02 100 µg

Recombinant Human CD66b/CEACAM8 Protein, N-His

Sign In for Pricing
View Details