Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf10 Rabbit Polyclonal Antibody (HRP)

C12orf10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYG, Gamm1, MST024, MSTP024, C12orf10

UniProt

Q86UA3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_067653

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF640R conjugate, 0.1mg/mL
BNC400485-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF594 conjugate, 0.1mg/mL
BNC940764-500 1x 500 µL

CD79a (IGA/764), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit
E-OSEL-M0017-01 24 Tests

QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit
E-OSEL-M0017-02 48 Tests

QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit
E-OSEL-M0017-03 96 Tests

QuicKey Pro Mouse ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
BTG2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF808149 100 µg

BTG2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]

Sign In for Pricing
View Details