Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE8 Rabbit Polyclonal Antibody (HRP)

CPNE8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86YQ8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CPNE8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_705898

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF10 (C-term) Rabbit Polyclonal Antibody
AP51653PU-N 400 µL

FGF10 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D aspartate oxidase (DDO) (NM_003649) Human Over-expression Lysate
LC401207 20 µg

D aspartate oxidase (DDO) (NM_003649) Human Over-expression Lysate

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF740 conjugate, 0.1mg/mL
BNC743257-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone Receptor 1 (PTH1R) Mouse Monoclonal Antibody [Clone ID: 4D2]
AM06494SU-N 100 µL

Parathyroid Hormone Receptor 1 (PTH1R) Mouse Monoclonal Antibody [Clone ID: 4D2]

Sign In for Pricing
View Details
EEA1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF813372 100 µg

EEA1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details
CF®594 Rabbit Anti-RFP
20422 100 µL

CF®594 Rabbit Anti-RFP

Sign In for Pricing
View Details