Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E1B Rabbit Polyclonal Antibody (FITC)

EIF4E1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ36951

UniProt

A6NMX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EIF4E1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001092878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM131B Protein Vector (Mouse) (pPB-N-His)
PV177267 500 ng

FAM131B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit
MBS9339472-01 48 Well

Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit

Sign In for Pricing
View Details
Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit
MBS9339472-02 96 Well

Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit

Sign In for Pricing
View Details
Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit
MBS9339472-03 5x 96 Well

Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit

Sign In for Pricing
View Details
Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit
MBS9339472-04 10x 96 Well

Mouse Suppressor of G2 allele of SKP1 homolog, SUGT1 ELISA Kit

Sign In for Pricing
View Details
Anti-Golgin 97/GOLGA1 Antibody Picoband (monoclonal, 8E4H1)
MBS1757938-01 0.01 mg

Anti-Golgin 97/GOLGA1 Antibody Picoband (monoclonal, 8E4H1)

Sign In for Pricing
View Details