Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E1B Rabbit Polyclonal Antibody (HRP)

EIF4E1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ36951

UniProt

A6NMX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EIF4E1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001092878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RING1 And YY1 Binding Protein (RYBP) ELISA Kit
abx390469 96 Tests

Mouse RING1 And YY1 Binding Protein (RYBP) ELISA Kit

Sign In for Pricing
View Details
Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples
MBS136003-01 1 Kit

Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples

Sign In for Pricing
View Details
Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples
MBS136003-02 5 Kits

Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples

Sign In for Pricing
View Details
Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples
MBS136003-03 5x 5 Kits

Active Human PAI-1 Functional Assay ELISA Kit for Non Plasma Samples

Sign In for Pricing
View Details
MDFIC discontinued
391468 200 µL

MDFIC discontinued

Sign In for Pricing
View Details
Rat Leptin Receptor (LEPR) ELISA Kit
RDR-LEPR-Ra-01 96 Tests

Rat Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details