Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZ2 Rabbit Polyclonal Antibody (HRP)

FEZ2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HUM3CL

UniProt

Q9UHY8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FEZ2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005093

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPK (ICEN37, Centromere Protein K, Interphase Centromere Complex Protein 37, Protein AF-5alpha, p33, FKSG14) (MaxLight 750) discontinued
124854-ML750 100 µL

CENPK (ICEN37, Centromere Protein K, Interphase Centromere Complex Protein 37, Protein AF-5alpha, p33, FKSG14) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ALG10 sgRNA CRISPR Lentivector set (Human)
K0073901 3x 1.0 µg

ALG10 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MRGRE Antibody
E19-4989 100 µg -100 µL

MRGRE Antibody

Sign In for Pricing
View Details
HER-2 Antibody / ErbB2
V7876SAF-100UG 100 µg

HER-2 Antibody / ErbB2

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1170923-01 0.02 mg (E-Coli)

Recombinant Acidiphilium cryptum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1170923-02 0.1 mg (E-Coli)

Recombinant Acidiphilium cryptum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details