Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Rabbit Polyclonal Antibody (Biotin)

HSPB11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP25, IFT25, FAP232, C1orf41, HSPCO34

UniProt

Q9Y547

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HSPB11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057210

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEURL Polyclonal Antibody, Cy5.5 Conjugated
bs-11897R-Cy5.5 100 µL

NEURL Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (PE)
MBS6491723-01 0.2 mL

PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (PE)

Sign In for Pricing
View Details
PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (PE)
MBS6491723-02 5x 0.2 mL

PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (PE)

Sign In for Pricing
View Details
Alpha Internexin/ NF-66 Antibody
orb319457 100 µL

Alpha Internexin/ NF-66 Antibody

Sign In for Pricing
View Details
Rabbit Anti Human OPRL1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8421977 Inquire

Rabbit Anti Human OPRL1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Mouse Monoclonal BOB1 Antibody (BOB1/7468) [DyLight 350]
NBP3-21057UV 0.1 mL

Mouse Monoclonal BOB1 Antibody (BOB1/7468) [DyLight 350]

Sign In for Pricing
View Details