Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Rabbit Polyclonal Antibody (HRP)

HSPB11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP25, IFT25, FAP232, C1orf41, HSPCO34

UniProt

Q9Y547

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSPB11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057210

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 18 (Cytokeratin 18, CK18, Keratin, Type I Cytoskeletal 18) (MaxLight 550)
138558-AF-ML550 100 µL

Keratin 18 (Cytokeratin 18, CK18, Keratin, Type I Cytoskeletal 18) (MaxLight 550)

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
MBS455927-01 48 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
MBS455927-02 96 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
MBS455927-03 5x 96 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
MBS455927-04 10x 96 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
CSN2 Human Pre-designed siRNA Set A
HY-RS03243 1 Set

CSN2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details