Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL1 Rabbit Polyclonal Antibody (HRP)

IGFL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UNQ644, APRG644

UniProt

Q6UW32

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGFL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_940943

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1328 (NM_146399) Mouse Tagged ORF Clone
MG212561 10 µg

Olfr1328 (NM_146399) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Atiprimod (free base)
MBS5813715 Inquire

Atiprimod (free base)

Sign In for Pricing
View Details
KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) (FITC)
130101-FITC 100 µL

KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) (FITC)

Sign In for Pricing
View Details
Mospd3 3'UTR Luciferase Stable Cell Line
TU213323 1.0 mL

Mospd3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Epithelial Membrane Antigen (EMA, CA15-3, Polymorphic Epithelial Mucin, PEM, Sialomucin or Episialin, MUC-1) (MaxLight 650)
MBS6220292-01 0.1 mL

Epithelial Membrane Antigen (EMA, CA15-3, Polymorphic Epithelial Mucin, PEM, Sialomucin or Episialin, MUC-1) (MaxLight 650)

Sign In for Pricing
View Details
Epithelial Membrane Antigen (EMA, CA15-3, Polymorphic Epithelial Mucin, PEM, Sialomucin or Episialin, MUC-1) (MaxLight 650)
MBS6220292-02 5x 0.1 mL

Epithelial Membrane Antigen (EMA, CA15-3, Polymorphic Epithelial Mucin, PEM, Sialomucin or Episialin, MUC-1) (MaxLight 650)

Sign In for Pricing
View Details