Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL36G Rabbit Polyclonal Antibody (HRP)

IL36G Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL1E, IL1F9, IL1H1, IL-1F9, IL-1H1, IL1RP2, IL-1RP2

UniProt

Q9NZH8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IL36G

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_062564

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF3 (NM_145725) Human Over-expression Lysate
LC403439 20 µg

TRAF3 (NM_145725) Human Over-expression Lysate

Sign In for Pricing
View Details
Lewis A (7LE), CF740 conjugate, 0.1mg/mL
BNC740311-100 1x 100 µL

Lewis A (7LE), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM16L (NM_001037330) Human Over-expression Lysate
LC400419 20 µg

TRIM16L (NM_001037330) Human Over-expression Lysate

Sign In for Pricing
View Details
IFFO (IFFO1) (NM_001193457) Human Over-expression Lysate
LC434317 20 µg

IFFO (IFFO1) (NM_001193457) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP Conjugated 5-HT (Serotonin) Recombinant Rabbit Monoclonal Antibody [PSH06-04]
HA722915 100 µL

HRP Conjugated 5-HT (Serotonin) Recombinant Rabbit Monoclonal Antibody [PSH06-04]

Sign In for Pricing
View Details
Human TMTC3 activation kit by CRISPRa
GA116001 1 Kit

Human TMTC3 activation kit by CRISPRa

Sign In for Pricing
View Details