Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhfpl3 Rabbit Polyclonal Antibody (FITC)

Lhfpl3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A930031L14Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Lhfpl3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYBPC1 (NM_002465) Human Tagged ORF Clone
RG214675 10 µg

MYBPC1 (NM_002465) Human Tagged ORF Clone

Sign In for Pricing
View Details
ARFGAP1 3'UTR Lenti-reporter-Luc Vector
12261081 1.0 µg

ARFGAP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FA2H Protein Vector (Rat) (pPB-C-His)
PV266958 500 ng

FA2H Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human CAMK2G shRNA (UAS) - Lentiviral human CAMK2G shRNA (UAS, iRFP) (25)
GTR15113270 1 Vial

Lentiviral human CAMK2G shRNA (UAS) - Lentiviral human CAMK2G shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SERPINB3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H2]
TA506973AM 100 µL

SERPINB3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H2]

Sign In for Pricing
View Details
CEP63 (NM_001042384) Human Tagged ORF Clone
RC224798 10 µg

CEP63 (NM_001042384) Human Tagged ORF Clone

Sign In for Pricing
View Details