Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia Enterocolitica mdh Protein (aa 1-311) (strain 8081)
VAng-Cr2034-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica mdh Protein (aa 1-311) (strain 8081)

Sign In for Pricing
View Details
CSTF3 Protein Vector (Mouse) (pPM-C-HA)
PV168588 500 ng

CSTF3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
BMP8A Recombinant Protein (Mouse)
RP119690 100 µg

BMP8A Recombinant Protein (Mouse)

Sign In for Pricing
View Details
COLEC10 (m) -PR
sc-142478-PR 10 µM - 20 µL

COLEC10 (m) -PR

Sign In for Pricing
View Details
Lentiviral human CCDC71 shRNA (UAS) - Lentiviral human CCDC71 shRNA (UAS) (100)
GTR15324645 1 Vial

Lentiviral human CCDC71 shRNA (UAS) - Lentiviral human CCDC71 shRNA (UAS) (100)

Sign In for Pricing
View Details
IRF5 Recombinant Antibody, Cy3 Conjugated
bsm-52117R-Cy3 100 µL

IRF5 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details