Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-B Recombinant Antibody, PE Conjugated
bsm-62217R-PE 100 µL

HLA-B Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Ac-(d-Arg)-CEH-(d-Phe)-RWC-NH2
MBS5821780 Inquire

Ac-(d-Arg)-CEH-(d-Phe)-RWC-NH2

Sign In for Pricing
View Details
Chicken Platelet-derived Growth Factor C, PDGF-C GENLISA ELISA
KLC0046 96 Well

Chicken Platelet-derived Growth Factor C, PDGF-C GENLISA ELISA

Sign In for Pricing
View Details
MRGPRE Protein Vector (Rat) (pPB-C-His)
PV282994 500 ng

MRGPRE Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Gabra1 Rat siRNA Oligo Duplex (Locus ID 29705)
SR502827 1 Kit

Gabra1 Rat siRNA Oligo Duplex (Locus ID 29705)

Sign In for Pricing
View Details
Lentiviral human GIPC2 sgRNA gene knockout kit - Lentiviral human GIPC2 sgRNA gene knockout kit (25)
GTR15359406 1 Vial

Lentiviral human GIPC2 sgRNA gene knockout kit - Lentiviral human GIPC2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details