Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans CBR1 Protein (aa 1-294)
VAng-Lsx05377-inquire Inquire

Recombinant Candida Albicans CBR1 Protein (aa 1-294)

Sign In for Pricing
View Details
Mouse Monoclonal Factor XII heavy chain Antibody (10-11-37) [Alexa Fluor 750]
NBP2-41377AF750 0.1 mL

Mouse Monoclonal Factor XII heavy chain Antibody (10-11-37) [Alexa Fluor 750]

Sign In for Pricing
View Details
Pigeon Melanin Concentrating Hormone (MCH) ELISA Kit
MBS9348860 Inquire

Pigeon Melanin Concentrating Hormone (MCH) ELISA Kit

Sign In for Pricing
View Details
Anti-Hu CD43 PE
MBS1801255-01 100 Tests

Anti-Hu CD43 PE

Sign In for Pricing
View Details
Anti-Hu CD43 PE
MBS1801255-02 5x 100 Tests

Anti-Hu CD43 PE

Sign In for Pricing
View Details
Mumps (AP) discontinued
M9215-10-AP 100 µL

Mumps (AP) discontinued

Sign In for Pricing
View Details