Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS9P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV782711 1.0 µg DNA

RPS9P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CDK10 Antibody
A53589-50UL 50 μL

CDK10 Antibody

Sign In for Pricing
View Details
APOB Protein Vector (Mouse) (pPB-N-His)
PV155243 500 ng

APOB Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human MYLPF Protein, His-SUMO, E.coli-100ug
QP8002-ec-100ug 100ug

Recombinant Human MYLPF Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
8-[[Tris (1-methylethyl) silyl]oxy]-1-octanol
439933 2.5 g

8-[[Tris (1-methylethyl) silyl]oxy]-1-octanol

Sign In for Pricing
View Details
Phospho-Tau (S202) Monoclonal Antibody, AbBy Fluor™ 750 Conjugated
bsm-63069R-BF750 100 µL

Phospho-Tau (S202) Monoclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details