Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NASP Antibody [Janelia Fluor 646]
NBP3-06445JF646 0.1 mL

Rabbit Polyclonal NASP Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
N-Tosyl-D-glutamic Acid
TRC-T663500-5G 5 g

N-Tosyl-D-glutamic Acid

Sign In for Pricing
View Details
Msra (NM_026322) Mouse Tagged Lenti ORF Clone
MR202816L3 10 µg

Msra (NM_026322) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tlx3 (NM_019916) Mouse Tagged Lenti ORF Clone
MR223697L3 10 µg

Tlx3 (NM_019916) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FKBP10 Human shRNA Plasmid Kit (Locus ID 60681)
TR304501 1 Kit

FKBP10 Human shRNA Plasmid Kit (Locus ID 60681)

Sign In for Pricing
View Details
IL-4 R α/CD124 Protein, Human, Recombinant (C-His)
E51P00889 100 µg

IL-4 R α/CD124 Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details