Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTPBP1 Polyclonal Antibody
MBS2573261-01 0.06 mL

AGTPBP1 Polyclonal Antibody

Sign In for Pricing
View Details
AGTPBP1 Polyclonal Antibody
MBS2573261-02 0.12 mL

AGTPBP1 Polyclonal Antibody

Sign In for Pricing
View Details
AGTPBP1 Polyclonal Antibody
MBS2573261-03 0.2 mL

AGTPBP1 Polyclonal Antibody

Sign In for Pricing
View Details
AGTPBP1 Polyclonal Antibody
MBS2573261-04 5x 0.2 mL

AGTPBP1 Polyclonal Antibody

Sign In for Pricing
View Details
NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (AP)
MBS6387634-01 0.1 mL

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (AP)

Sign In for Pricing
View Details
NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (AP)
MBS6387634-02 5x 0.1 mL

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (AP)

Sign In for Pricing
View Details