Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Kappa Antibody (HP6156), PerCP
HB980147-01 1 Each

Anti-Human Kappa Antibody (HP6156), PerCP

Sign In for Pricing
View Details
Anti-Human Kappa Antibody (HP6156), PerCP
HB980147-02 100 Tests

Anti-Human Kappa Antibody (HP6156), PerCP

Sign In for Pricing
View Details
Recombinant Human ATXN2
P0515-01 50 µg

Recombinant Human ATXN2

Sign In for Pricing
View Details
Recombinant Human ATXN2
P0515-02 200 µg

Recombinant Human ATXN2

Sign In for Pricing
View Details
Recombinant Human ATXN2
P0515-03 1 mg

Recombinant Human ATXN2

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Uncharacterized protein YjeA (yjeA)
MBS1125345-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype O:1b Uncharacterized protein YjeA (yjeA)

Sign In for Pricing
View Details