Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-DGKZ
YF-PA15675 50 ug

anti-DGKZ

Sign In for Pricing
View Details
(S) -Alprenolol (L-tartrate)
HY-121692A 1 Each

(S) -Alprenolol (L-tartrate)

Sign In for Pricing
View Details
ATP8B2 (NM_020452) Human Tagged ORF Clone Lentiviral Particle
RC211700L3V 200 µL

ATP8B2 (NM_020452) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CYP2C62P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV722078 1.0 µg DNA

CYP2C62P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Salmonella agona Nitric oxide reductase FlRd-NAD (+) reductase
MBS1045913-01 0.02 mg (E-Coli)

Recombinant Salmonella agona Nitric oxide reductase FlRd-NAD (+) reductase

Sign In for Pricing
View Details
Recombinant Salmonella agona Nitric oxide reductase FlRd-NAD (+) reductase
MBS1045913-02 0.02 mg (Yeast)

Recombinant Salmonella agona Nitric oxide reductase FlRd-NAD (+) reductase

Sign In for Pricing
View Details