Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin)
MBS6302547-01 0.2 mL

GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin)

Sign In for Pricing
View Details
GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin)
MBS6302547-02 5x 0.2 mL

GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-MCT4 Antibody, Affinity Purified
A304-439A 100 µg

Rabbit anti-MCT4 Antibody, Affinity Purified

Sign In for Pricing
View Details
Mouse Monoclonal HBsAg Antibody (Hs41) [FITC]
NB100-73139F 0.2 mL

Mouse Monoclonal HBsAg Antibody (Hs41) [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal Ki67/MKI67 Antibody (8D5) [mFluor Violet 450 SE]
NBP2-22112MFV450 0.1 mL

Mouse Monoclonal Ki67/MKI67 Antibody (8D5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
BRE 3'UTR Luciferase Stable Cell Line
TU001897 1.0 mL

BRE 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details