Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arntl2 (NM_001289681) Mouse Untagged Clone
MC227245 10 µg

Arntl2 (NM_001289681) Mouse Untagged Clone

Sign In for Pricing
View Details
FGF basic (119-126) (human, bovine, ovine, rabbit)
5-01134 4x 5 mg

FGF basic (119-126) (human, bovine, ovine, rabbit)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM192 + SPM265) - Azide and BSA Free
NBP3-08640 100 µg

Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM192 + SPM265) - Azide and BSA Free

Sign In for Pricing
View Details
Mouse Monoclonal alpha-Synuclein Antibody (4F1) [Janelia Fluor 635]
NBP3-18259JF635 0.1 mL

Mouse Monoclonal alpha-Synuclein Antibody (4F1) [Janelia Fluor 635]

Sign In for Pricing
View Details
Recombinant Human IL4 Protein, C-His
E55P5591 50 µg

Recombinant Human IL4 Protein, C-His

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (AP) discontinued
247071-AP 100 µL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (AP) discontinued

Sign In for Pricing
View Details