Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP17L2 siRNA Oligos set (Human)
49288171 3x 5 nmol

USP17L2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CNN2 Recombinant Protein (Human)
RP038182 100 µg

CNN2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Tau, phosphorylated (S356) discontinued
340659-01 100 µL

Tau, phosphorylated (S356) discontinued

Sign In for Pricing
View Details
Tau, phosphorylated (S356) discontinued
340659-02 200 µL

Tau, phosphorylated (S356) discontinued

Sign In for Pricing
View Details
CORO6 Antibody (C-term) [APR15565G]
APR15565G-01 50 µL

CORO6 Antibody (C-term) [APR15565G]

Sign In for Pricing
View Details
CORO6 Antibody (C-term) [APR15565G]
APR15565G-02 100 µL

CORO6 Antibody (C-term) [APR15565G]

Sign In for Pricing
View Details