Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnd2 (NM_001010953) Rat Tagged Lenti ORF Clone
RR209220L4 10 µg

Rnd2 (NM_001010953) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Pichia pastoris AIM11 Protein (aa 1-199)
VAng-Cr6563-inquire Inquire

Recombinant Pichia pastoris AIM11 Protein (aa 1-199)

Sign In for Pricing
View Details
TNNI2, NT (TNNI2, Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform) (Azide free) (HRP) discontinued
043106-HRP 200 µL

TNNI2, NT (TNNI2, Troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Dnajb7 shRNA (UAS) - Lentiviral mouse Dnajb7 shRNA (UAS, RFP) plasmid
GTR15125233 1 Vial

Lentiviral mouse Dnajb7 shRNA (UAS) - Lentiviral mouse Dnajb7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-CanAg Reference Antibody (Cantuzumab)
M34024-1 100 µg

Anti-CanAg Reference Antibody (Cantuzumab)

Sign In for Pricing
View Details
C22orf19 (C22orf19, Fmip, PK1.3, fSAP79, Fms-interacting protein, NF2/meningioma region protein pK1.3, functional spliceosome-associated protein 79, placental protein 39.2)
588262 50 µg

C22orf19 (C22orf19, Fmip, PK1.3, fSAP79, Fms-interacting protein, NF2/meningioma region protein pK1.3, functional spliceosome-associated protein 79, placental protein 39.2)

Sign In for Pricing
View Details