Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucoalyssin
HY-N12953 1 Each

Glucoalyssin

Sign In for Pricing
View Details
DMWD, CT (DMWD, DM9, Dystrophia myotonica WD repeat-containing protein, Dystrophia myotonica-containing WD repeat motif protein, Protein 59, Protein DMR-N9) (MaxLight 405) discontinued
034688-ML405 100 µL

DMWD, CT (DMWD, DM9, Dystrophia myotonica WD repeat-containing protein, Dystrophia myotonica-containing WD repeat motif protein, Protein 59, Protein DMR-N9) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MUP6 Double Nickase Plasmid (m2)
sc-436902-NIC-2 20 µg

MUP6 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
CYP3A7 Antibody
MBS7131794-01 0.1 mL

CYP3A7 Antibody

Sign In for Pricing
View Details
CYP3A7 Antibody
MBS7131794-02 5x 0.1 mL

CYP3A7 Antibody

Sign In for Pricing
View Details
DIO3 Antibody
ABD8532 100 µg

DIO3 Antibody

Sign In for Pricing
View Details