Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf79 (1-156, His-tag) Human Protein
AR51441PU-S 20 µg

C20orf79 (1-156, His-tag) Human Protein

Sign In for Pricing
View Details
ZNF7 ORF Vector (Human) (pORF)
51739011 1.0 µg DNA

ZNF7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CFH/Complement Factor H Goat anti-Human Polyclonal Antibody
MBS2402505-01 0.5 mL

CFH/Complement Factor H Goat anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
CFH/Complement Factor H Goat anti-Human Polyclonal Antibody
MBS2402505-02 5x 0.5 mL

CFH/Complement Factor H Goat anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
OR7E121P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1539207 1.0 µg DNA

OR7E121P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-IMP4 Antibody
CQA8700-01 30 µL

Anti-IMP4 Antibody

Sign In for Pricing
View Details